Primary Antibodies

View as table Download

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LCMT1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LCMT1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase

Rabbit Polyclonal Anti-STS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY

Goat Polyclonal Antibody against HSD11B1 / HDL

Applications WB
Reactivities Human (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1.

LCMT1 mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700109, TA700110

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR