Primary Antibodies

Jump to Filters
View as table Download
Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody
TA348005

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-HO-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 365.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody
TA327035

USD 365.00

3 Weeks

Rabbit anti-HMOX1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HMOX1
Heme Oxygenase 1 (HMOX1) (Center) Rabbit Polyclonal Antibody
AP52064PU-N

USD 580.00

2 Weeks

Heme Oxygenase 1 (HMOX1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of Human Heme oxygenase 1 / HMOX1
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335239

USD 539.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR