DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
USD 509.00
5 Days
DPPA2 mouse monoclonal antibody,clone 1G10, Biotinylated
Applications | WB |
Reactivities | Human, Dog, Rat |
Conjugation | Biotin |
DPPA2 mouse monoclonal antibody,clone 1G10, HRP conjugated
Applications | WB |
Reactivities | Human, Dog, Rat |
Conjugation | HRP |
Anti-DPPA2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2 |
Anti-DPPA2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2 |
DPPA2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-DPPA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DPPA2 antibody: synthetic peptide directed towards the N terminal of human DPPA2. Synthetic peptide located within the following region: NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL |
DPPA2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3). |
Modifications | Unmodified |