Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-MLH3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MLH3. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-MLH3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLH3 antibody: synthetic peptide directed towards the middle region of human MLH3. Synthetic peptide located within the following region: SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP |
MLH3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1180-1429 of human MLH3 (NP_055196.2). |
| Modifications | Unmodified |
