Rabbit Polyclonal antibody to CacyBP (calcyclin binding protein)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of CacyBP (Uniprot ID#Q9HB71) |
USD 430.00
3 Weeks
SIAH Interacting Protein (CACYBP) mouse monoclonal antibody, clone AT3G8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 315.00
3 Weeks
SIAH Interacting Protein (CACYBP) mouse monoclonal antibody, clone AT3G8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CACYBP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACYBP antibody: synthetic peptide directed towards the middle region of human CACYBP. Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK |
Germany
Japan
United Kingdom
China
