Primary Antibodies

View as table Download

NFATC4 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 635-689 of Human NFATc4.

Rabbit polyclonal NFAT3 (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T).

Anti-NFATC4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4

Rabbit polyclonal NFATC4 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NFATC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 744-773 amino acids from the C-terminal region of human NFATC4.

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the middle region of human NFATC4. Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV

Anti-NFATC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4. Synthetic peptide located within the following region: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE

NFATC4 goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the C Terminus of the protein sequence according to NP_004545.2, NP_001185894.1, NP_001185895.1, NP_001185896.1.

NFATC4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4. Synthetic peptide located within the following region: RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSL