Germany
Japan
United Kingdom
China
RPS24 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 72~101 amino acids from the Central region of Human RPS24 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-RPS24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPS24 antibody: synthetic peptide directed towards the middle region of human RPS24. Synthetic peptide located within the following region: GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT |
