RPS15 (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RPS15 |
RPS15 (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RPS15 |
Rabbit polyclonal anti-RPS15 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS15. |
Rabbit Polyclonal Anti-RPS15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS15 Antibody: synthetic peptide directed towards the middle region of human RPS15. Synthetic peptide located within the following region: GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL |