Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NTSR1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen NTSR1 / NTR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human NTSR1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Panda, Dog, Horse (88%).

Rabbit Polyclonal Anti-Neurotensin Receptor 1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide EQNRSADGQHAGGLVC corresponding to amino acid residues 209-224 of human Neurotensin Receptor 1. 2nd extracellular loop.

Rabbit Polyclonal Anti-NTSR1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NTSR1 / NTR antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human NTSR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Elephant (94%); Marmoset (89%); Hamster (83%).

Neurotensin Receptor 1 (NTSR1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen NTSR1 antibody was raised against synthetic peptide

Neurotensin Receptor 1 (NTSR1) mouse monoclonal antibody, clone B-N6, Azide Free

Applications FC, FN
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-NTSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT

Anti-NTSR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 402-418 amino acids of Human neurotensin receptor 1 (high affinity)

Neurotensin Receptor 1 (NTSR1) mouse monoclonal antibody, clone B-N6, Purified

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-NTR1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NTR1.

NTSR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human NTSR1