Primary Antibodies

Jump to Filters
View as table Download
A RAF (ARAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]
TA803675AM

USD 509.00

2 Weeks

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
A RAF (ARAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA803675BM

USD 509.00

2 Weeks

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
A RAF (ARAF) Rabbit Polyclonal Antibody
TA308536

USD 625.00

5 Days

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F8]
TA803658S

USD 200.00

2 Days

ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA803662S

USD 200.00

2 Days

ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

A RAF (ARAF) Rabbit Polyclonal Antibody
TA313468

USD 380.00

In Stock

Rabbit polyclonal anti-A-RAF antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human A-RAF.
A RAF (ARAF) Rabbit Polyclonal Antibody
TA335018

USD 539.00

5 Days

Rabbit Polyclonal Anti-ARAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW
A RAF (ARAF) Rabbit Polyclonal Antibody
TA354371

USD 425.00

5 Days

Rabbit anti Raf -A Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A Synthetic peptide derived from N-term of Raf-A conjugated to KLH