Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Polyclonal Antibody against STEAP4 / Dudulin4
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CVDNTLTRIRQGWERN, from the C Terminus of the protein sequence according to NP_078912.2. |
STEAP4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP4 antibody was raised against synthetic peptide from human STEAP4. |
Rabbit Polyclonal STEAP4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP4 antibody was raised against a 14 amino acid peptide from near the center of human STEAP4. |
Rabbit Polyclonal Anti-STEAP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STEAP4 antibody: synthetic peptide directed towards the C terminal of human STEAP4. Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA |
