Primary Antibodies

Jump to Filters
View as table Download
PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody
TA349650

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1B
PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody
TA331347

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ