Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to DAP5 (eukaryotic translation initiation factor 4 gamma, 2)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Rabbit, Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 194 of DAP5

Anti-EIF4G2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 796-812 amino acids of Human Eukaryotic translation initiation factor 4 gamma 2

Rabbit Polyclonal Anti-EIF4G2 Antibody

Applications WB
Reactivities Human, Chicken, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the C terminal of human EIF4G2. Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV

Anti-EIF4G2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 796-812 amino acids of Human Eukaryotic translation initiation factor 4 gamma 2

Rabbit polyclonal anti-EIF4G2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EIF4G2.

Rabbit Polyclonal Anti-EIF4G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the N terminal of human EIF4G2. Synthetic peptide located within the following region: PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL