Primary Antibodies

Jump to Filters
View as table Download
Il5 Rabbit Polyclonal Antibody
TA335656

USD 539.00

5 Days

Rabbit Polyclonal Anti-Il5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL
IL5 Rabbit Polyclonal Antibody
TA347874

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5