Primary Antibodies

Jump to Filters
View as table Download
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA312603

USD 380.00

In Stock

Rabbit polyclonal anti-RAD51L1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD51L1.
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA344637

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA344636

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW