Primary Antibodies

Jump to Filters
View as table Download
Alpha Dystroglycan (DAG1) Rabbit Polyclonal Antibody
TA339411

USD 539.00

5 Days

Rabbit Polyclonal Anti-DAG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAG1 antibody: synthetic peptide directed towards the middle region of human DAG1. Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT
Alpha Dystroglycan (DAG1) Goat Polyclonal Antibody
TA311294

USD 520.00

5 Days

Goat Anti-DAG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3.