Primary Antibodies

Jump to Filters
View as table Download
HSD3B2 Rabbit Polyclonal Antibody
TA334658

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
HSD3B2 Rabbit Polyclonal Antibody
TA350068

USD 380.00

In Stock

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B2
HSD3B2 Rabbit Polyclonal Antibody
TA332437

USD 365.00

3 Weeks

Rabbit anti-HSD3B2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HSD3B2