Rabbit Polyclonal Anti-ATG4B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B. Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B Antibody: A synthesized peptide derived from human ATG4B |
Goat Polyclonal Anti-FCRL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FCRL1 Antibody: Peptide with sequence C-SRLRKANITDVD, from the C Terminus of the protein sequence according to NP_443170.1; NP_001152870.1. |
Germany
Japan
United Kingdom
China