Goat Polyclonal Antibody against PPAR delta (Isoform 1)
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1. |
Rabbit polyclonal PPARD Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPARD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human PPARD. |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARD Antibody: synthetic peptide directed towards the middle region of human PPARD. Synthetic peptide located within the following region: NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIET |
Rabbit anti PPARb Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The full-length recombinant protein of human PPAR-beta. |
Rabbit anti PPARd Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China