Primary Antibodies

Jump to Filters
View as table Download
myosin heavy chain 9 (MYH9) Mouse Monoclonal Antibody [Clone ID: 2B3]
AM31696PU-N

USD 535.00

2 Weeks

myosin heavy chain 9 (MYH9) mouse monoclonal antibody, clone 2B3, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
myosin heavy chain 9 (MYH9) Rabbit Polyclonal Antibody
TA346515

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYH9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK