Primary Antibodies

View as table Download

Anti-CUL5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human cullin 5

Rabbit Polyclonal Anti-CUL5 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL5 antibody: synthetic peptide directed towards the C terminal of human CUL5. Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

Rabbit polyclonal antibody to Cullin5 (cullin 5)

Reactivities Human (Predicted: Mouse, Feline, Rabbit)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 113 and 583 of Cullin 5 (Uniprot ID#Q93034)