Germany
Japan
United Kingdom
China
Rabbit Anti-Testicular Receptor 4 (TR4) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the N-terminal region of mouse TR4 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-NR2C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK |
Rabbit Polyclonal Anti-NR2C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: FTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVIL |
NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NR2C2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NR2C2 mouse monoclonal antibody, clone OTI7E6 (formerly 7E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".