Primary Antibodies

Jump to Filters
View as table Download
WNT6 Rabbit Polyclonal Antibody
TA317519

USD 515.00

5 Days

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Human, Rabbit, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster)
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).
WNT1 Rabbit Polyclonal Antibody
TA319438

USD 765.00

5 Days

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Mouse, Human, Bovine, Dog, Macaque, Rat, Opossum
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.
WNT1 Mouse Monoclonal Antibody [Clone ID: 13F9]
TA319584

USD 780.00

5 Days

Mouse monoclonal anti-Wnt1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
WNT2 Rabbit Polyclonal Antibody
TA329906

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR
LEF1 Rabbit Polyclonal Antibody
TA330116

USD 539.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN
SFRP1 Rabbit Polyclonal Antibody
TA330411

USD 485.00

5 Days

Rabbit Polyclonal Anti-SFRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRP1 antibody: synthetic peptide directed towards the middle region of human SFRP1. Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
DKK1 Rabbit Polyclonal Antibody
TA341113

USD 515.00

5 Days

Rabbit Polyclonal Anti-DKK1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen DKK1 antibody was raised against synthetic 15 amino acid peptide from 1st cytoplasmic domain of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%).
WNT1 Rabbit Polyclonal Antibody
TA341204

USD 515.00

5 Days

Rabbit Polyclonal Anti-WNT1 Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Chicken)
Conjugation Unconjugated
Immunogen WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%).
WNT2 Rabbit Polyclonal Antibody
TA341208

USD 515.00

5 Days

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Mouse, Rat, Bat, Bovine, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Guinea Pig)
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).
WNT6 Rabbit Polyclonal Antibody
TA341844

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG
SFRP4 Rabbit Polyclonal Antibody
TA361069

USD 539.00

5 Days

SFRP4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SFRP4