Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
| Applications | WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1R heavy chain. |
Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1R. |
C1R goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The subunit C1r is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
Rabbit Polyclonal Anti-C1R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ |
Active filters
Category
- Antibodies
Target Symbol
- C1R
Conjugates
- Unconjugated
Pathways
- Systemic lupus erythematosus