Primary Antibodies

Jump to Filters
View as table Download
MAT2B (N-term) Rabbit Polyclonal Antibody
AP52614PU-N

USD 580.00

2 Weeks

MAT2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 86~116 amino acids from the N-terminal region of human MAT2B
MAT2B Goat Polyclonal Antibody
TA311407

USD 520.00

5 Days

Goat Anti-MAT2B (isoform 1) Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence REKELSIHFVPGS-C, from the N Terminus of the protein sequence according to NP_037415.1.
MAT2B Rabbit Polyclonal Antibody
TA342138

USD 539.00

5 Days

Rabbit polyclonal Anti-MAT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the N terminal of human MAT2B. Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA
MAT2B Rabbit Polyclonal Antibody
TA342139

USD 539.00

5 Days

Rabbit polyclonal Anti-MAT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the middle region of human MAT2B. Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE