Primary Antibodies

Jump to Filters
View as table Download
POLR1D Rabbit Polyclonal Antibody
TA366094

USD 380.00

4 Weeks

POLR1D rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human POLR1D
POLR1D Rabbit Polyclonal Antibody
TA370448

USD 380.00

4 Weeks

POLR1D rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human POLR1D
POLR1D Rabbit Polyclonal Antibody
TA346781

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF