Rabbit Polyclonal Antibody against Mre11
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit Polyclonal Antibody against Mre11
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MRE11A |
Rabbit Polyclonal MRE11 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11. |
MRE11 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MRE11 |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MRE11A |
MRE11 Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human MRE11 (NP_005581.2). |
Modifications | Unmodified |
MRE11 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 400-500 of Human MRE11. |
Rabbit anti-MRE11A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MRE11A |
Rabbit polyclonal Anti-MRE11A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM |
Mre11 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Mre11 |
Mre11 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Mre11 |
Rabbit polyclonal anti-Mre11 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein. |
Rabbit polyclonal anti-Mre11 antibody
Applications | IP |
Reactivities | Saccharomyces cerevisiae |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 578-590 of Saccharomyces cerevisiae (baker's yeast) Mre11 protein. |
Rabbit polyclonal Anti-MRE11A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the middle region of human MRE11A. Synthetic peptide located within the following region: RFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAE |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A |