Primary Antibodies

View as table Download

Anti-ANAPC10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-ANAPC10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal anti-APC10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10.

Rabbit Polyclonal APC10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10.

Rabbit Polyclonal Anti-ANAPC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10. Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL