Rabbit polyclonal anti-RUFY1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RUFY1. |
Rabbit polyclonal anti-RUFY1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RUFY1. |
Goat Anti-RUFY1 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKNEAITSFEGKT, from the internal region of the protein sequence according to NP_079434.3; NP_001035541.1. |
Rabbit Polyclonal Anti-RUFY1 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUFY1 antibody: synthetic peptide directed towards the C terminal of human RUFY1. Synthetic peptide located within the following region: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL |