Primary Antibodies

Jump to Filters
View as table Download
RUFY1 Rabbit Polyclonal Antibody
TA315826

USD 380.00

In Stock

Rabbit polyclonal anti-RUFY1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RUFY1.
RUFY1 Goat Polyclonal Antibody
TA311533

USD 520.00

5 Days

Goat Anti-RUFY1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKNEAITSFEGKT, from the internal region of the protein sequence according to NP_079434.3; NP_001035541.1.
RUFY1 Rabbit Polyclonal Antibody
TA330472

USD 539.00

5 Days

Rabbit Polyclonal Anti-RUFY1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUFY1 antibody: synthetic peptide directed towards the C terminal of human RUFY1. Synthetic peptide located within the following region: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL