Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EHD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EHD4 Antibody: synthetic peptide directed towards the middle region of human EHD4. Synthetic peptide located within the following region: LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA

Rabbit Polyclonal Anti-EHD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EHD4 Antibody: synthetic peptide directed towards the middle region of human EHD4. Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT