Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MYBBP1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MYBBP1A

Rabbit polyclonal anti-MYBBP1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human MYBBP1A

Rabbit Polyclonal Anti-Mybbp1a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mybbp1a antibody: synthetic peptide directed towards the middle region of mouse Mybbp1a. Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ

MYBBP1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYBBP1A

MYBBP1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated