Primary Antibodies

View as table Download

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Rabbit Polyclonal c-Myc Antibody

Applications ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Anti-BCL2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-54 amino acids of Human B-cell CLL/lymphoma 2

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Rabbit Polyclonal Caspase-9 Antibody

Applications FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).

Rabbit Polyclonal Caspase-9 Antibody

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: FLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDI

Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1.

Anti-CASP9 (active) Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2

Rabbit polyclonal Cyclin E1 (Ab-395) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P).