Goat Polyclonal Antibody against EXOC7
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DNIKNDPDKEYN, from the internal region of the protein sequence according to NP_001013861.1; NP_056034.2. |
Rabbit polyclonal antibody to EXOC7 (exocyst complex component 7)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 74 and 335 of EXOC7 (Uniprot ID#Q9UPT5) |
Rabbit polyclonal antibody to EXOC7 (exocyst complex component 7)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 735 of EXOC7 (Uniprot ID#Q9UPT5) |
Rabbit Polyclonal Anti-EXOC7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOC7 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOC7. Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK |
Germany
Japan
United Kingdom
China
