Primary Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) C4B mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-C4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM