Primary Antibodies

Jump to Filters
View as table Download
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
TA500700

USD 447.00

In Stock

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
TA500700S

USD 200.00

In Stock

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Glutaminase (GLS) Rabbit Polyclonal Antibody
TA334558

USD 539.00

5 Days

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT