Primary Antibodies

Jump to Filters
View as table Download
PTEN Mouse Monoclonal Antibody [Clone ID: OTI5A5]
TA807116

USD 447.00

In Stock

PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5)

Applications IHC
Reactivities Mouse, Rat
Conjugation Unconjugated
PTEN Mouse Monoclonal Antibody [Clone ID: OTI1C3]
TA801053

USD 447.00

In Stock

PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Reactivities Human
Conjugation Unconjugated
PTEN Mouse Monoclonal Antibody [Clone ID: OTI2H9]
TA801108

USD 447.00

In Stock

PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Reactivities Human
Conjugation Unconjugated
SKIP (INPP5K) Rabbit Polyclonal Antibody
TA343120

USD 539.00

In Stock

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF
PTEN Rabbit Polyclonal Antibody
TA313350

USD 380.00

In Stock

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.
PTEN Rabbit Polyclonal Antibody
TA327812

USD 380.00

In Stock

Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370
Modifications Phospho-specific
PTEN Rabbit Polyclonal Antibody
TA327872

USD 380.00

In Stock

Rabbit Polyclonal PTEN Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTEN