Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
RAB5A mouse monoclonal antibody,clone OTI6D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB5A mouse monoclonal antibody,clone OTI6D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
RAB5A mouse monoclonal antibody,clone OTI6D9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
RAB5A mouse monoclonal antibody,clone OTI6D9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS |
Goat Polyclonal Anti-Rab5a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli. |
Anti-RAB5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Anti-RAB5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Rabbit polyclonal Rab4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | C-terminal peptide from human Rab4 |
Rabbit Polyclonal Anti-Rab5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab5 Antibody: Peptide sequence around aa.188~192( N-P-G-A-N) derived from Human Rab5. |
Active filters
Target Symbol
- RAB5
Reactivities
- Mouse
Applications
- WB