Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DKK2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DKK2

Goat Polyclonal Antibody against DKK2

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence ATYSSKARLHVCQKI, from the C Terminus of the protein sequence according to NP_055236.

Rabbit Polyclonal Anti-Dkk2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dkk2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMP