Rabbit Polyclonal Anti-DKK2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK2 |
Rabbit Polyclonal Anti-DKK2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK2 |
Goat Polyclonal Antibody against DKK2
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ATYSSKARLHVCQKI, from the C Terminus of the protein sequence according to NP_055236. |
Rabbit Polyclonal Anti-Dkk2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dkk2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMP |