Primary Antibodies

Jump to Filters
View as table Download
RPS18 (Center) Rabbit Polyclonal Antibody
AP17722PU-N

USD 580.00

In Stock

RPS18 (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 62-91 amino acids from the Central region of Human RS18.
RPS18 Rabbit Polyclonal Antibody
TA314493

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPS18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RPS18.
RPS18 Rabbit Polyclonal Antibody
TA330910

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPS18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK