Primary Antibodies

Jump to Filters
View as table Download
RPL3 Rabbit Polyclonal Antibody
TA314452

USD 380.00

In Stock

Rabbit polyclonal anti-RPL3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL3.
RPL3 Rabbit Polyclonal Antibody
TA346542

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL3 antibody: synthetic peptide directed towards the N terminal of human RPL3. Synthetic peptide located within the following region: DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMV
RPL3 Rabbit Polyclonal Antibody
TA346543

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL3 antibody: synthetic peptide directed towards the C terminal of human RPL3. Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY