Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
RPL10A mouse monoclonal antibody,clone OTI4B2
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPL10A mouse monoclonal antibody,clone OTI2G9
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-RPL10A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL10A antibody: synthetic peptide directed towards the middle region of human RPL10A. Synthetic peptide located within the following region: YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK |
Rabbit Polyclonal Anti-RPL10A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL10A antibody: synthetic peptide directed towards the N terminal of human RPL10A. Synthetic peptide located within the following region: MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS |
Active filters
Target Symbol
- RPL10A
Applications
- WB
Pathways
- Ribosome