Primary Antibodies

Jump to Filters
View as table Download
HADHB (C-term) Rabbit Polyclonal Antibody
AP51996PU-N

USD 580.00

2 Weeks

HADHB (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 321~351 amino acids from the C-terminal region of human HADHB
HADHB Rabbit Polyclonal Antibody
TA308352

USD 625.00

In Stock

Rabbit polyclonal antibody to HADHB (hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit)

Applications WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 43 of HADHB (Uniprot ID#P55084)
HADHB Rabbit Polyclonal Antibody
TA346528

USD 539.00

5 Days

Rabbit Polyclonal Anti-HADHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HADHB antibody: synthetic peptide directed towards the C terminal of human HADHB. Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE