CYP21A2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP21A2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP21A2 mouse monoclonal antibody,clone OTI3D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP21A2 mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYP21A2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYP21A2 mouse monoclonal antibody,clone OTI3D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYP21A2 mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYP21A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP21A2 |
Rabbit Polyclonal Anti-CYP21A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
Rabbit polyclonal anti-CYP21A2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CYP21A2. |
CYP21A2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYP21A2 mouse monoclonal antibody,clone OTI3D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYP21A2 mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".