Primary Antibodies

Jump to Filters
View as table Download
HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody
TA314008

USD 380.00

In Stock

Rabbit polyclonal anti-HA2Q antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q.
HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody
TA342062

USD 539.00

5 Days

Rabbit Polyclonal Anti-HLA-DPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT