Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TNFRSF10C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF10C antibody: synthetic peptide directed towards the N terminal of human TNFRSF10C. Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG

DcR1 (TNFRSF10C) mouse monoclonal antibody, clone B-H47, Azide Free

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF10C Rabbit Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFRSF10C