PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
PPP4C Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of human PPP4C (NP_002711.1). |
Modifications | Unmodified |
Goat Anti-PPP4C Antibody
Applications | IHC, WB |
Reactivities | Human, Rat (Expected from sequence similarity: Dog, Rabbit) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PQETRGIPSKKP, from the C-Terminus of the protein sequence according to NP_002711.1. |
PPP4C rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A PP X/C peptide conjugated to KLH |
PPP4C sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A PP X/C peptide conjugated to KLH |
Rabbit Polyclonal Anti-PPP4C Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP |