Rabbit Polyclonal Anti-Atf4 Antibody
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Goat Polyclonal Antibody against ATF4
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666. |
Rabbit Polyclonal Anti-ATF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the middle region of human ATF4. Synthetic peptide located within the following region: LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGS |
Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATF-4. |
| Modifications | Phospho-specific |
Rabbit polyclonal ATF-4 (Ab-219) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ATF4. |
Rabbit polyclonal ATF4 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-198 amino acids from the Central region of human ATF4. |
Rabbit Polyclonal Anti-ATF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the C terminal of human ATF4. Synthetic peptide located within the following region: EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLK |
Germany
Japan
United Kingdom
China
