Primary Antibodies

Jump to Filters
View as table Download
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 445.00

3 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
TREX1 Rabbit Polyclonal Antibody
TA306702

USD 570.00

2 Weeks

Rabbit Polyclonal TREX1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TREX1 antibody was raised against a 15 amino acid peptide near the center of human TREX1.
MAVS Rabbit Polyclonal Antibody
TA306399

USD 570.00

2 Weeks

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA.
MAVS Rabbit Polyclonal Antibody
TA351386

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS
MAVS Rabbit Polyclonal Antibody
TA306400

USD 570.00

5 Days

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA.
Macrophage Inflammatory Protein 1 beta (CCL4) Rabbit Polyclonal Antibody
TA319702

USD 570.00

5 Days

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.
Interferon beta (IFNB1) Rabbit Polyclonal Antibody
AP05706PU-N

USD 590.00

5 Days

Interferon beta (IFNB1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A 17 amino acid peptide located near the centre of human Interferon beta.
Macrophage Inflammatory Protein 1 beta (CCL4L2) Rabbit Polyclonal Antibody
TA324311

USD 580.00

5 Days

Rabbit polyclonal CCL4 Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CCL4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-48 amino acids from the Central region of human CCL4.
MAVS Rabbit Polyclonal Antibody
TA332896

USD 365.00

3 Weeks

Rabbit anti-MAVS Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAVS
RANTES (CCL5) Rabbit Polyclonal Antibody
TA342306

USD 485.00

5 Days

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN