MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal antibody to VAM1 (membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6))
Applications | IHC, WB |
Reactivities | Human (Predicted: Chimpanzee, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of VAM1 (Uniprot ID#Q9NZW5) |
Rabbit Polyclonal Anti-MPP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MPP6 |
VAM1 (MPP6) (Center) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 367-396aa) of human MPP6 / MAGUK p55 subfamily member 6 |
Goat Polyclonal Antibody against MPP6
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QQVLENLTELPSS-C, from the N Terminus of the protein sequence according to NP_057531.2. |
Rabbit Polyclonal Anti-MPP6 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mpp6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mpp6. Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT |
MPP6 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MPP6 |
MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".