Germany
Japan
United Kingdom
China
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit Polyclonal 5-HT7 Antibody
| Applications | FC, ICC/IF, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1). |
5HT7 Receptor (HTR7) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
5HT7 Receptor (HTR7) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 404-433 amino acids from the C-terminal region of Human Serotonin receptor 7 (HTR7). |
Goat Anti-HTR7 / 5-HT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QNADYCRKKGHDS, from the C Terminus of the protein sequence according to NP_000863.1. |
Rabbit Polyclonal Anti-HTR7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
Rabbit Polyclonal Anti-HTR7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
Active filters
Target Symbol
- 5HT7 RECEPTOR
Applications
- WB
Families
- GPCR
Pathways
- Calcium signaling pathway